SCOPe 2.08: Domain d3eura1: 3eur A:1-139

Lineage for d3eura1 (3eur A:1-139)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Bacteroides fragilis [TaxId:272559] [188839] (3 PDB entries)

8. Domain d3eura1: 3eur A:1-139 [245922]
   Other proteins in same PDB: d3eura2
   automated match to d3hcza_

Details for d3eura1

PDB Entry: 3eur, 1.3 Å

PDB Description: Crystal structure of the C-terminal domain of uncharacterized protein from Bacteroides fragilis NCTC 9343

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3eura1:

Sequence; same for both SEQRES and ATOM records:

>d3eura1 c.47.1.0 (A:1-139) automated matches {Bacteroides fragilis [TaxId: 272559]}
knrlgtkalnftytldsgvkgtlyqfpaeytllfinnpgchacaemieglkaspvingft
aakklkvlsiypdeeldewkkhrndfakewtngydkelviknknlydlraiptlylldkn
ktvllkdatlqkveqylae

Timeline for d3eura1:

• d3eura1 first appeared in SCOPe 2.04, called d3eura_
  
• d3eura1 appears in SCOPe 2.07