SCOPe 2.06: Domain d3eu1c_: 3eu1 C:

Lineage for d3eu1c_ (3eu1 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries)

8. Domain d3eu1c_: 3eu1 C: [245920]
   automated match to d3d1aa_
   complexed with hem

Details for d3eu1c_

PDB Entry: 3eu1, 3 Å

PDB Description: crystal structure determination of goat hemoglobin (capra hircus) at 3 angstrom resolution

PDB Compounds: (C:) Hemoglobin subunit alpha-1/2

SCOPe Domain Sequences for d3eu1c_:

Sequence; same for both SEQRES and ATOM records:

>d3eu1c_ a.1.1.2 (C:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
vhasldkflanvstvltskyr

Timeline for d3eu1c_:

• d3eu1c_ first appeared in SCOPe 2.04
  
• d3eu1c_ appears in SCOPe 2.05
  
• d3eu1c_ appears in SCOPe 2.07
  
• d3eu1c_ appears in the current release, SCOPe 2.08