Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries) |
Domain d3eu1b_: 3eu1 B: [245919] automated match to d3d1ab_ complexed with hem |
PDB Entry: 3eu1 (more details), 3 Å
SCOPe Domain Sequences for d3eu1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eu1b_ a.1.1.2 (B:) automated matches {Goat (Capra hircus) [TaxId: 9925]} mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse ftpllqaefqkvvagvanalahryh
Timeline for d3eu1b_: