SCOPe 2.08: Domain d3etec2: 3ete C:209-498

Lineage for d3etec2 (3ete C:209-498)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225674] (6 PDB entries)

8. Domain d3etec2: 3ete C:209-498 [245911]
   Other proteins in same PDB: d3etea1, d3eteb1, d3etec1, d3eted1, d3etee1, d3etef1
   automated match to d3etda2
   complexed with glu, gtp, h3p, ndp

Details for d3etec2

PDB Entry: 3ete, 3 Å

PDB Description: crystal structure of bovine glutamate dehydrogenase complexed with hexachlorophene

PDB Compounds: (C:) glutamate dehydrogenase

SCOPe Domain Sequences for d3etec2:

Sequence; same for both SEQRES and ATOM records:

>d3etec2 c.2.1.7 (C:209-498) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagv

Timeline for d3etec2:

• d3etec2 first appeared in SCOPe 2.04
  
• d3etec2 appears in SCOPe 2.07