Lineage for d1mnea1 (1mne A:34-79)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310527Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 1310528Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 1310529Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 1310563Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)
  8. 1310583Domain d1mnea1: 1mne A:34-79 [24590]
    Other proteins in same PDB: d1mnea2
    complexed with mg, pop

Details for d1mnea1

PDB Entry: 1mne (more details), 2.7 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mg-pyrophosphate
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1mnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnea1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq

SCOPe Domain Coordinates for d1mnea1:

Click to download the PDB-style file with coordinates for d1mnea1.
(The format of our PDB-style files is described here.)

Timeline for d1mnea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mnea2