SCOPe 2.05: Domain d3eo1j1: 3eo1 J:1-107

Lineage for d3eo1j1 (3eo1 J:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)

8. Domain d3eo1j1: 3eo1 J:1-107 [245894]
   Other proteins in same PDB: d3eo1a2, d3eo1c_, d3eo1d2, d3eo1f_, d3eo1g2, d3eo1i_, d3eo1j2, d3eo1l_
   automated match to d1dn0a1

Details for d3eo1j1

PDB Entry: 3eo1, 3.1 Å

PDB Description: Structure of the Fab Fragment of GC-1008 in Complex with Transforming Growth Factor-Beta 3

PDB Compounds: (J:) GC-1008 Fab Light Chain

SCOPe Domain Sequences for d3eo1j1:

Sequence; same for both SEQRES and ATOM records:

>d3eo1j1 b.1.1.1 (J:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrlei

Timeline for d3eo1j1:

• d3eo1j1 first appeared in SCOPe 2.04
  
• d3eo1j1 appears in SCOPe 2.06
  
• d3eo1j1 appears in the current release, SCOPe 2.08