Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries) |
Domain d1d1aa1: 1d1a A:34-79 [24589] Other proteins in same PDB: d1d1aa2 |
PDB Entry: 1d1a (more details), 2 Å
SCOP Domain Sequences for d1d1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1aa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq
Timeline for d1d1aa1: