Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
Domain d3eo1a1: 3eo1 A:1-107 [245885] Other proteins in same PDB: d3eo1a2, d3eo1c_, d3eo1d2, d3eo1f_, d3eo1g2, d3eo1i_, d3eo1j2, d3eo1l_ automated match to d1dn0a1 |
PDB Entry: 3eo1 (more details), 3.1 Å
SCOPe Domain Sequences for d3eo1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eo1a1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrlei
Timeline for d3eo1a1: