Lineage for d3eo1a1 (3eo1 A:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2025015Domain d3eo1a1: 3eo1 A:1-107 [245885]
    Other proteins in same PDB: d3eo1a2, d3eo1c_, d3eo1d2, d3eo1f_, d3eo1g2, d3eo1i_, d3eo1j2, d3eo1l_
    automated match to d1dn0a1

Details for d3eo1a1

PDB Entry: 3eo1 (more details), 3.1 Å

PDB Description: Structure of the Fab Fragment of GC-1008 in Complex with Transforming Growth Factor-Beta 3
PDB Compounds: (A:) GC-1008 Fab Light Chain

SCOPe Domain Sequences for d3eo1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eo1a1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrlei

SCOPe Domain Coordinates for d3eo1a1:

Click to download the PDB-style file with coordinates for d3eo1a1.
(The format of our PDB-style files is described here.)

Timeline for d3eo1a1: