SCOPe 2.04: Domain d3eh3b2: 3eh3 B:37-168

Lineage for d3eh3b2 (3eh3 B:37-168)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (29 PDB entries)

8. Domain d3eh3b2: 3eh3 B:37-168 [245865]
   Other proteins in same PDB: d3eh3a_, d3eh3b1
   automated match to d3qjsb2
   complexed with cu1, cua, has, hem

Details for d3eh3b2

PDB Entry: 3eh3, 3.1 Å

PDB Description: structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3eh3b2:

Sequence; same for both SEQRES and ATOM records:

>d3eh3b2 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

Timeline for d3eh3b2:

• d3eh3b2 is new in SCOPe 2.04-stable
  
• d3eh3b2 appears in SCOPe 2.05
  
• d3eh3b2 appears in the current release, SCOPe 2.08