Lineage for d3eh3b1 (3eh3 B:3-36)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697026Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1697048Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1697156Family f.17.2.0: automated matches [227239] (1 protein)
    not a true family
  6. 1697157Protein automated matches [226999] (2 species)
    not a true protein
  7. 1697161Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries)
  8. 1697168Domain d3eh3b1: 3eh3 B:3-36 [245864]
    Other proteins in same PDB: d3eh3a_, d3eh3b2
    automated match to d2qpdb2
    complexed with cu1, cua, has, hem

Details for d3eh3b1

PDB Entry: 3eh3 (more details), 3.1 Å

PDB Description: structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3eh3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eh3b1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dqhkahkailayekgwlafslamlfvfialiayt

SCOPe Domain Coordinates for d3eh3b1:

Click to download the PDB-style file with coordinates for d3eh3b1.
(The format of our PDB-style files is described here.)

Timeline for d3eh3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eh3b2
View in 3D
Domains from other chains:
(mouse over for more information)
d3eh3a_