SCOPe 2.05: Domain d3eh3a_: 3eh3 A:

Lineage for d3eh3a_ (3eh3 A:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81437] (25 PDB entries)

8. Domain d3eh3a_: 3eh3 A: [245863]
   Other proteins in same PDB: d3eh3b1, d3eh3b2
   automated match to d1xmea_
   complexed with cu1, cua, has, hem

Details for d3eh3a_

PDB Entry: 3eh3, 3.1 Å

PDB Description: structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3eh3a_:

Sequence; same for both SEQRES and ATOM records:

>d3eh3a_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy
yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll
aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym
avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya
iiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv
avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv
nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv
wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi
yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt
lvqlfghlnpvpgwrlw

Timeline for d3eh3a_:

• d3eh3a_ first appeared in SCOPe 2.04
  
• d3eh3a_ appears in SCOPe 2.06
  
• d3eh3a_ appears in the current release, SCOPe 2.08