![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) ![]() |
![]() | Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
![]() | Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries) |
![]() | Domain d1fmwa1: 1fmw A:34-79 [24586] Other proteins in same PDB: d1fmwa2 complexed with atp, mg |
PDB Entry: 1fmw (more details), 2.15 Å
SCOP Domain Sequences for d1fmwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmwa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq
Timeline for d1fmwa1: