Lineage for d1fmwa1 (1fmw A:34-79)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295836Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 295837Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 295838Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 295865Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)
  8. 295881Domain d1fmwa1: 1fmw A:34-79 [24586]
    Other proteins in same PDB: d1fmwa2
    complexed with atp, mg

Details for d1fmwa1

PDB Entry: 1fmw (more details), 2.15 Å

PDB Description: crystal structure of the mgatp complex for the motor domain of dictyostelium myosin ii

SCOP Domain Sequences for d1fmwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmwa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

SCOP Domain Coordinates for d1fmwa1:

Click to download the PDB-style file with coordinates for d1fmwa1.
(The format of our PDB-style files is described here.)

Timeline for d1fmwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fmwa2