SCOPe 2.04: Domain d3edea1: 3ede A:3-95

Lineage for d3edea1 (3ede A:3-95)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries)

8. Domain d3edea1: 3ede A:3-95 [245831]
   Other proteins in same PDB: d3edea2, d3edea3, d3edeb2, d3edeb3
   automated match to d1h3ga1
   complexed with ca, gol

Details for d3edea1

PDB Entry: 3ede, 1.71 Å

PDB Description: structural base for cyclodextrin hydrolysis

PDB Compounds: (A:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edea1:

Sequence; same for both SEQRES and ATOM records:

>d3edea1 b.1.18.0 (A:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]}
ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
eigpeaqpgsfdivfkgdgrseryryrllareq

Timeline for d3edea1:

• d3edea1 is new in SCOPe 2.04-stable
  
• d3edea1 appears in SCOPe 2.05
  
• d3edea1 appears in the current release, SCOPe 2.08