SCOP 1.73: Domain d1d0ya1: 1d0y A:34-79

Lineage for d1d0ya1 (1d0y A:34-79)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)

8. Domain d1d0ya1: 1d0y A:34-79 [24581]
   Other proteins in same PDB: d1d0ya2

Details for d1d0ya1

PDB Entry: 1d0y, 2 Å

PDB Description: dictyostelium myosin s1dc (motor domain fragment) complexed with o- nitrophenyl aminoethyldiphosphate beryllium fluoride.

PDB Compounds: (A:) myosin s1dc motor domain

SCOP Domain Sequences for d1d0ya1:

Sequence; same for both SEQRES and ATOM records:

>d1d0ya1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Timeline for d1d0ya1:

• d1d0ya1 first appeared (with stable ids) in SCOP 1.55
  
• d1d0ya1 appears in SCOP 1.71
  
• d1d0ya1 appears in SCOP 1.75
  
• d1d0ya1 appears in the current release, SCOPe 2.08