Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255810] (3 PDB entries) |
Domain d3e9ya3: 3e9y A:460-668 [245802] Other proteins in same PDB: d3e9ya2 automated match to d1ybha3 complexed with 1ms, fab, mg, nhe, tdm |
PDB Entry: 3e9y (more details), 3 Å
SCOPe Domain Sequences for d3e9ya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9ya3 c.36.1.0 (A:460-668) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv icphqehvlpmipsggtfndvitegdgri
Timeline for d3e9ya3: