SCOPe 2.06: Domain d3e9ya2: 3e9y A:281-459

Lineage for d3e9ya2 (3e9y A:281-459)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (11 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255811] (2 PDB entries)

8. Domain d3e9ya2: 3e9y A:281-459 [245801]
   Other proteins in same PDB: d3e9ya1, d3e9ya3
   automated match to d1ybha1
   complexed with 1ms, fab, mg, nhe, tdm

Details for d3e9ya2

PDB Entry: 3e9y, 3 Å

PDB Description: Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron

PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d3e9ya2:

Sequence; same for both SEQRES and ATOM records:

>d3e9ya2 c.31.1.0 (A:281-459) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvattlmglgsypc
ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae
igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg

Timeline for d3e9ya2:

• d3e9ya2 first appeared in SCOPe 2.04
  
• d3e9ya2 appears in SCOPe 2.05
  
• d3e9ya2 appears in SCOPe 2.07
  
• d3e9ya2 appears in the current release, SCOPe 2.08