Lineage for d3e9ya1 (3e9y A:87-280)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122891Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2122892Protein automated matches [227126] (20 species)
    not a true protein
  7. 2123226Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255810] (2 PDB entries)
  8. 2123229Domain d3e9ya1: 3e9y A:87-280 [245800]
    Other proteins in same PDB: d3e9ya2
    automated match to d1ybha2
    complexed with 1ms, fab, mg, nhe, tdm

Details for d3e9ya1

PDB Entry: 3e9y (more details), 3 Å

PDB Description: Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron
PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d3e9ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e9ya1 c.36.1.0 (A:87-280) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheqg
gvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtdaf
qetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaipn
weqamrlpgymsrm

SCOPe Domain Coordinates for d3e9ya1:

Click to download the PDB-style file with coordinates for d3e9ya1.
(The format of our PDB-style files is described here.)

Timeline for d3e9ya1: