SCOP 1.65: Domain d1lvk_1: 1lvk 34-79

Lineage for d1lvk_1 (1lvk 34-79)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.34: SH3-like barrel [50036] (13 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)

8. Domain d1lvk_1: 1lvk 34-79 [24576]
   Other proteins in same PDB: d1lvk_2
   complexed with bef, mg, mnt; mutant

Details for d1lvk_1

PDB Entry: 1lvk, 1.9 Å

PDB Description: x-ray crystal structure of the mg (dot) 2'(3')-o-(n-methylanthraniloyl) nucleotide bound to dictyostelium discoideum myosin motor domain

SCOP Domain Sequences for d1lvk_1:

Sequence; same for both SEQRES and ATOM records:

>d1lvk_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

Timeline for d1lvk_1:

• d1lvk_1 first appeared (with stable ids) in SCOP 1.55
  
• d1lvk_1 appears in SCOP 1.63
  
• d1lvk_1 appears in SCOP 1.67
  
• d1lvk_1 appears in the current release, SCOPe 2.08, called d1lvka1