Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
Domain d3e1f25: 3e1f 2:731-1023 [245755] Other proteins in same PDB: d3e1f11, d3e1f12, d3e1f13, d3e1f14, d3e1f21, d3e1f22, d3e1f23, d3e1f24, d3e1f31, d3e1f32, d3e1f33, d3e1f34, d3e1f41, d3e1f42, d3e1f43, d3e1f44 automated match to d1jz8a4 complexed with dms, gal, mg, na |
PDB Entry: 3e1f (more details), 3 Å
SCOPe Domain Sequences for d3e1f25:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1f25 b.30.5.0 (2:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3e1f25:
View in 3D Domains from same chain: (mouse over for more information) d3e1f21, d3e1f22, d3e1f23, d3e1f24 |