Lineage for d3e1f15 (3e1f 1:731-1023)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052583Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2053055Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2053056Protein automated matches [226849] (7 species)
    not a true protein
  7. 2053066Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 2053135Domain d3e1f15: 3e1f 1:731-1023 [245750]
    Other proteins in same PDB: d3e1f11, d3e1f12, d3e1f13, d3e1f14, d3e1f21, d3e1f22, d3e1f23, d3e1f24, d3e1f31, d3e1f32, d3e1f33, d3e1f34, d3e1f41, d3e1f42, d3e1f43, d3e1f44
    automated match to d1jz8a4
    complexed with dms, gal, mg, na

Details for d3e1f15

PDB Entry: 3e1f (more details), 3 Å

PDB Description: e.coli (lacz) beta-galactosidase (h418e) in complex with galactose
PDB Compounds: (1:) beta-galactosidase

SCOPe Domain Sequences for d3e1f15:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e1f15 b.30.5.0 (1:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3e1f15:

Click to download the PDB-style file with coordinates for d3e1f15.
(The format of our PDB-style files is described here.)

Timeline for d3e1f15: