Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d3e1f12: 3e1f 1:220-333 [245747] Other proteins in same PDB: d3e1f11, d3e1f13, d3e1f15, d3e1f21, d3e1f23, d3e1f25, d3e1f31, d3e1f33, d3e1f35, d3e1f41, d3e1f43, d3e1f45 automated match to d1jz8a1 complexed with dms, gal, mg, na |
PDB Entry: 3e1f (more details), 3 Å
SCOPe Domain Sequences for d3e1f12:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1f12 b.1.4.0 (1:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3e1f12:
View in 3D Domains from same chain: (mouse over for more information) d3e1f11, d3e1f13, d3e1f14, d3e1f15 |