Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (32 species) not a true protein |
Species Clostridium acetobutylicum [TaxId:1488] [255806] (1 PDB entry) |
Domain d3e10b_: 3e10 B: [245745] automated match to d3kwka_ complexed with edo, epe, fmn |
PDB Entry: 3e10 (more details), 1.4 Å
SCOPe Domain Sequences for d3e10b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e10b_ d.90.1.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 1488]} mdiinnrrsirnykgkkvekekiekllraamqapsagnqqpwefivledrenidklsnfs kyanslktaplaivlladeekmkisemweqdmaaaaenilleaayldlgavwlgaqpiee rvknlkemfnlksnikpfcvisvgypensenkfidrfdakrihieky
Timeline for d3e10b_: