SCOPe 2.08: Domain d3e10b_: 3e10 B:

Lineage for d3e10b_ (3e10 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.0: automated matches [191446] (1 protein)
   not a true family

6. Protein automated matches [190672] (32 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:1488] [255806] (1 PDB entry)

8. Domain d3e10b_: 3e10 B: [245745]
   automated match to d3kwka_
   complexed with edo, epe, fmn

Details for d3e10b_

PDB Entry: 3e10, 1.4 Å

PDB Description: crystal structure of putative nadh oxidase (np_348178.1) from clostridium acetobutylicum at 1.40 a resolution

PDB Compounds: (B:) Putative NADH Oxidase

SCOPe Domain Sequences for d3e10b_:

Sequence; same for both SEQRES and ATOM records:

>d3e10b_ d.90.1.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
mdiinnrrsirnykgkkvekekiekllraamqapsagnqqpwefivledrenidklsnfs
kyanslktaplaivlladeekmkisemweqdmaaaaenilleaayldlgavwlgaqpiee
rvknlkemfnlksnikpfcvisvgypensenkfidrfdakrihieky

Timeline for d3e10b_:

• d3e10b_ first appeared in SCOPe 2.04
  
• d3e10b_ appears in SCOPe 2.07