Class b: All beta proteins [48724] (177 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (7 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
Domain d3dypd5: 3dyp D:731-1023 [245738] Other proteins in same PDB: d3dypa1, d3dypa2, d3dypa3, d3dypa4, d3dypb1, d3dypb2, d3dypb3, d3dypb4, d3dypc1, d3dypc2, d3dypc3, d3dypc4, d3dypd1, d3dypd2, d3dypd3, d3dypd4 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 3dyp (more details), 1.75 Å
SCOPe Domain Sequences for d3dypd5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dypd5 b.30.5.0 (D:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3dypd5:
View in 3D Domains from same chain: (mouse over for more information) d3dypd1, d3dypd2, d3dypd3, d3dypd4 |