Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d3dypc1: 3dyp C:13-219 [245729] Other proteins in same PDB: d3dypa2, d3dypa3, d3dypa4, d3dypa5, d3dypb2, d3dypb3, d3dypb4, d3dypb5, d3dypc2, d3dypc3, d3dypc4, d3dypc5, d3dypd2, d3dypd3, d3dypd4, d3dypd5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3dyp (more details), 1.75 Å
SCOPe Domain Sequences for d3dypc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dypc1 b.18.1.0 (C:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3dypc1:
View in 3D Domains from same chain: (mouse over for more information) d3dypc2, d3dypc3, d3dypc4, d3dypc5 |