Lineage for d3dyoc3 (3dyo C:334-625)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570672Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1570673Protein automated matches [190075] (60 species)
    not a true protein
  7. 1570748Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 1570759Domain d3dyoc3: 3dyo C:334-625 [245711]
    Other proteins in same PDB: d3dyoa1, d3dyoa2, d3dyoa4, d3dyoa5, d3dyob1, d3dyob2, d3dyob4, d3dyob5, d3dyoc1, d3dyoc2, d3dyoc4, d3dyoc5, d3dyod1, d3dyod2, d3dyod4, d3dyod5
    automated match to d1jz7a5
    complexed with dms, ipt, mg, na

Details for d3dyoc3

PDB Entry: 3dyo (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (h418n) in complex with iptg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3dyoc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dyoc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeanietngmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3dyoc3:

Click to download the PDB-style file with coordinates for d3dyoc3.
(The format of our PDB-style files is described here.)

Timeline for d3dyoc3: