SCOPe 2.05: Domain d3dymd5: 3dym D:731-1023

Lineage for d3dymd5 (3dym D:731-1023)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.0: automated matches [227145] (1 protein)
   not a true family

6. Protein automated matches [226849] (5 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)

8. Domain d3dymd5: 3dym D:731-1023 [245698]
   Other proteins in same PDB: d3dyma1, d3dyma2, d3dyma3, d3dyma4, d3dymb1, d3dymb2, d3dymb3, d3dymb4, d3dymc1, d3dymc2, d3dymc3, d3dymc4, d3dymd1, d3dymd2, d3dymd3, d3dymd4
   automated match to d1jz8a4
   complexed with dms, mg, na

Details for d3dymd5

PDB Entry: 3dym, 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (h418e)

PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3dymd5:

Sequence; same for both SEQRES and ATOM records:

>d3dymd5 b.30.5.0 (D:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

Timeline for d3dymd5:

• d3dymd5 first appeared in SCOPe 2.04
  
• d3dymd5 appears in SCOPe 2.06
  
• d3dymd5 appears in the current release, SCOPe 2.08