Lineage for d3dymc1 (3dym C:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775086Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2775129Domain d3dymc1: 3dym C:13-219 [245689]
    Other proteins in same PDB: d3dyma2, d3dyma3, d3dyma4, d3dyma5, d3dymb2, d3dymb3, d3dymb4, d3dymb5, d3dymc2, d3dymc3, d3dymc4, d3dymc5, d3dymd2, d3dymd3, d3dymd4, d3dymd5
    automated match to d1f49a3
    complexed with dms, mg, na

Details for d3dymc1

PDB Entry: 3dym (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (h418e)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3dymc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dymc1 b.18.1.0 (C:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3dymc1:

Click to download the PDB-style file with coordinates for d3dymc1.
(The format of our PDB-style files is described here.)

Timeline for d3dymc1: