Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d3dymc1: 3dym C:13-219 [245689] Other proteins in same PDB: d3dyma2, d3dyma3, d3dyma4, d3dyma5, d3dymb2, d3dymb3, d3dymb4, d3dymb5, d3dymc2, d3dymc3, d3dymc4, d3dymc5, d3dymd2, d3dymd3, d3dymd4, d3dymd5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3dym (more details), 2.05 Å
SCOPe Domain Sequences for d3dymc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dymc1 b.18.1.0 (C:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3dymc1:
View in 3D Domains from same chain: (mouse over for more information) d3dymc2, d3dymc3, d3dymc4, d3dymc5 |