Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries) |
Domain d1br4a1: 1br4 A:34-79 [24568] Other proteins in same PDB: d1br4a2, d1br4b_, d1br4c2, d1br4d_, d1br4e2, d1br4f_, d1br4g2, d1br4h_ complexed with adp, bef, mg |
PDB Entry: 1br4 (more details), 3.62 Å
SCOPe Domain Sequences for d1br4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1br4a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn
Timeline for d1br4a1: