![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (47 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
![]() | Domain d3dyma1: 3dym A:13-219 [245679] Other proteins in same PDB: d3dyma2, d3dyma3, d3dyma4, d3dyma5, d3dymb2, d3dymb3, d3dymb4, d3dymb5, d3dymc2, d3dymc3, d3dymc4, d3dymc5, d3dymd2, d3dymd3, d3dymd4, d3dymd5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3dym (more details), 2.05 Å
SCOPe Domain Sequences for d3dyma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dyma1 b.18.1.0 (A:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3dyma1:
![]() Domains from same chain: (mouse over for more information) d3dyma2, d3dyma3, d3dyma4, d3dyma5 |