Class b: All beta proteins [48724] (177 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
Protein Photosynthetic reaction centre [50348] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries) Uniprot P11846 |
Domain d3dtrh2: 3dtr H:36-250 [245660] Other proteins in same PDB: d3dtrh1, d3dtrl_, d3dtrm_ automated match to d2j8dh2 complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant |
PDB Entry: 3dtr (more details), 3.1 Å
SCOPe Domain Sequences for d3dtrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dtrh2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d3dtrh2: