SCOPe 2.08: Domain d3dsym_: 3dsy M:

Lineage for d3dsym_ (3dsy M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
   Uniprot P02953

8. Domain d3dsym_: 3dsy M: [245658]
   Other proteins in same PDB: d3dsyh1, d3dsyh2, d3dsyl_
   automated match to d2j8dm_
   complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d3dsym_

PDB Entry: 3dsy, 3 Å

PDB Description: e(l212)q mutant structure of photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3dsym_:

Sequence; same for both SEQRES and ATOM records:

>d3dsym_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d3dsym_:

• d3dsym_ first appeared in SCOPe 2.04
  
• d3dsym_ appears in SCOPe 2.07