Lineage for d3dezb_ (3dez B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892109Species Streptococcus mutans [TaxId:1309] [255798] (1 PDB entry)
  8. 2892111Domain d3dezb_: 3dez B: [245633]
    Other proteins in same PDB: d3deza2
    automated match to d4ohca_
    complexed with so4

Details for d3dezb_

PDB Entry: 3dez (more details), 2.4 Å

PDB Description: crystal structure of orotate phosphoribosyltransferase from streptococcus mutans
PDB Compounds: (B:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3dezb_:

Sequence, based on SEQRES records: (download)

>d3dezb_ c.61.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
mtlakdiardlldikavylkpeepftwasgikspiytdnritlsypetrtliengfveti
keafpeveviagtatagiphgaiiadkmnlplayirskpkdhgagnqiegrvtkgqkmvi
iedlistggsvldavaaaqregadvlgvvaiftyelpkatanfekasvklvtlsnyseli
kvakvqgyidadgltllkkfkenqetwq

Sequence, based on observed residues (ATOM records): (download)

>d3dezb_ c.61.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
mtlakdiardlldikavylkpeepftkspiytdnritlsypetrtliengfvetikeafp
eveviagtatagiphgaiiadkmnlplayirsqiegrvtkgqkmviiedlistggsvlda
vaaaqregadvlgvvaiftyelpkatanfekasvklvtlsnyselikvakvqgyidadgl
tllkkfkenqetwq

SCOPe Domain Coordinates for d3dezb_:

Click to download the PDB-style file with coordinates for d3dezb_.
(The format of our PDB-style files is described here.)

Timeline for d3dezb_: