Class b: All beta proteins [48724] (180 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) automatically mapped to Pfam PF00431 |
Family b.23.1.0: automated matches [254288] (1 protein) not a true family |
Protein automated matches [254671] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries) |
Domain d3dema3: 3dem A:166-278 [245628] Other proteins in same PDB: d3dema2, d3demb2 automated match to d1nt0a2 complexed with ca, nag |
PDB Entry: 3dem (more details), 2.3 Å
SCOPe Domain Sequences for d3dema3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dema3 b.23.1.0 (A:166-278) automated matches {Human (Homo sapiens) [TaxId: 9606]} csdnlftqrtgvitspdfpnpypksseclytieleegfmvnlqfedifdiedhpevpcpy dyikikvgpkvlgpfcgekapepistqshsvlilfhsdnsgenrgwrlsyraa
Timeline for d3dema3: