Lineage for d3dema1 (3dem A:7-120)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532394Fold b.23: CUB-like [49853] (4 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1532395Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 1532430Family b.23.1.0: automated matches [254288] (1 protein)
    not a true family
  6. 1532431Protein automated matches [254671] (1 species)
    not a true protein
  7. 1532432Species Human (Homo sapiens) [TaxId:9606] [255797] (1 PDB entry)
  8. 1532433Domain d3dema1: 3dem A:7-120 [245626]
    Other proteins in same PDB: d3dema2, d3demb2
    automated match to d1nt0a1
    complexed with ca, nag

Details for d3dema1

PDB Entry: 3dem (more details), 2.3 Å

PDB Description: cub1-egf-cub2 domain of human masp-1/3
PDB Compounds: (A:) Complement factor MASP-3

SCOPe Domain Sequences for d3dema1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dema1 b.23.1.0 (A:7-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nmfgqiqspgypdsypsdsevtwnitvpdgfriklyfmhfnlessylceydyvkvetedq
vlatfcgrettdteqtpgqevvlspgsfmsitfrsdfsneerftgfdahymavd

SCOPe Domain Coordinates for d3dema1:

Click to download the PDB-style file with coordinates for d3dema1.
(The format of our PDB-style files is described here.)

Timeline for d3dema1: