Lineage for d3dbsa4 (3dbs A:726-1091)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1674829Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1674830Protein automated matches [190417] (19 species)
    not a true protein
  7. 1674960Species Human (Homo sapiens) [TaxId:9606] [187294] (476 PDB entries)
  8. 1675559Domain d3dbsa4: 3dbs A:726-1091 [245623]
    Other proteins in same PDB: d3dbsa1, d3dbsa2, d3dbsa3
    automated match to d1e7ua4
    complexed with gd9

Details for d3dbsa4

PDB Entry: 3dbs (more details), 2.8 Å

PDB Description: Structure of PI3K gamma in complex with GDC0941
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3dbsa4:

Sequence, based on SEQRES records: (download)

>d3dbsa4 d.144.1.0 (A:726-1091) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlv

Sequence, based on observed residues (ATOM records): (download)

>d3dbsa4 d.144.1.0 (A:726-1091) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtg
mpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv

SCOPe Domain Coordinates for d3dbsa4:

Click to download the PDB-style file with coordinates for d3dbsa4.
(The format of our PDB-style files is described here.)

Timeline for d3dbsa4: