Class a: All alpha proteins [46456] (285 folds) |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (23 PDB entries) |
Domain d3dbsa3: 3dbs A:525-725 [245622] Other proteins in same PDB: d3dbsa1, d3dbsa2, d3dbsa4 automated match to d1e7ua1 complexed with gd9 |
PDB Entry: 3dbs (more details), 2.8 Å
SCOPe Domain Sequences for d3dbsa3:
Sequence, based on SEQRES records: (download)
>d3dbsa3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d3dbsa3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea ylrgcg
Timeline for d3dbsa3: