Lineage for d3dbsa3 (3dbs A:525-725)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1501071Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 1501072Protein automated matches [190220] (10 species)
    not a true protein
  7. 1501096Species Human (Homo sapiens) [TaxId:9606] [189070] (23 PDB entries)
  8. 1501115Domain d3dbsa3: 3dbs A:525-725 [245622]
    Other proteins in same PDB: d3dbsa1, d3dbsa2, d3dbsa4
    automated match to d1e7ua1
    complexed with gd9

Details for d3dbsa3

PDB Entry: 3dbs (more details), 2.8 Å

PDB Description: Structure of PI3K gamma in complex with GDC0941
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3dbsa3:

Sequence, based on SEQRES records: (download)

>d3dbsa3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d3dbsa3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d3dbsa3:

Click to download the PDB-style file with coordinates for d3dbsa3.
(The format of our PDB-style files is described here.)

Timeline for d3dbsa3: