SCOPe 2.04: Domain d1br2d1: 1br2 D:34-79

Lineage for d1br2d1 (1br2 D:34-79)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
Domain d1br2d1: 1br2 D:34-79 [24561]
Other proteins in same PDB: d1br2a2, d1br2b2, d1br2c2, d1br2d2, d1br2e2, d1br2f2
complexed with adp, alf, mg

Details for d1br2d1

PDB Entry: 1br2 (more details), 2.9 Å

PDB Description: smooth muscle myosin motor domain complexed with mgadp.alf4

PDB Compounds: (D:) myosin

SCOPe Domain Sequences for d1br2d1:

Sequence, based on SEQRES records: (download)

>d1br2d1 b.34.3.1 (D:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

Sequence, based on observed residues (ATOM records): (download)

>d1br2d1 b.34.3.1 (D:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmn

SCOPe Domain Coordinates for d1br2d1:

Click to download the PDB-style file with coordinates for d1br2d1.
(The format of our PDB-style files is described here.)

Timeline for d1br2d1: