Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) automatically mapped to Pfam PF10436 |
Family a.29.5.0: automated matches [230678] (1 protein) not a true family |
Protein automated matches [230679] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries) |
Domain d3d2rb1: 3d2r B:20-180 [245606] Other proteins in same PDB: d3d2ra2, d3d2rb2 automated match to d2bu8a1 complexed with adp, gol, mg |
PDB Entry: 3d2r (more details), 2.03 Å
SCOPe Domain Sequences for d3d2rb1:
Sequence, based on SEQRES records: (download)
>d3d2rb1 a.29.5.0 (B:20-180) automated matches {Human (Homo sapiens) [TaxId: 9606]} vprevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptql vntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgii eykdactvdpvtnqnlqyfldrfymnristrmlmnqhilif
>d3d2rb1 a.29.5.0 (B:20-180) automated matches {Human (Homo sapiens) [TaxId: 9606]} vprevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptql vntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgii eykactvdpvtnqnlqyfldrfymnristrmlmnqhilif
Timeline for d3d2rb1: