Lineage for d3czjb1 (3czj B:13-219)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1777873Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 1777915Domain d3czjb1: 3czj B:13-219 [245582]
    Other proteins in same PDB: d3czja2, d3czja3, d3czja4, d3czja5, d3czjb2, d3czjb3, d3czjb4, d3czjb5, d3czjc2, d3czjc3, d3czjc4, d3czjc5, d3czjd2, d3czjd3, d3czjd4, d3czjd5
    automated match to d1f49a3
    complexed with 149, dms, mg, na

Details for d3czjb1

PDB Entry: 3czj (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460t) in complex with d- galctopyranosyl-1-one
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3czjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czjb1 b.18.1.0 (B:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3czjb1:

Click to download the PDB-style file with coordinates for d3czjb1.
(The format of our PDB-style files is described here.)

Timeline for d3czjb1: