Class b: All beta proteins [48724] (149 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries) |
Domain d2mysa1: 2mys A:34-79 [24557] Other proteins in same PDB: d2mysa2, d2mysb_, d2mysc_ complexed with mg, mly, so4 |
PDB Entry: 2mys (more details), 2.8 Å
SCOP Domain Sequences for d2mysa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mysa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle} akssvfvvhpkqsfvkgtiqskeggkvtvkteggetltvkedqvfs
Timeline for d2mysa1: