SCOP 1.71: Domain d2mysa1: 2mys A:34-79

Lineage for d2mysa1 (2mys A:34-79)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)

8. Domain d2mysa1: 2mys A:34-79 [24557]
   Other proteins in same PDB: d2mysa2, d2mysb_, d2mysc_
   complexed with mg, mly, so4

Details for d2mysa1

PDB Entry: 2mys, 2.8 Å

PDB Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains

SCOP Domain Sequences for d2mysa1:

Sequence; same for both SEQRES and ATOM records:

>d2mysa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
akssvfvvhpkqsfvkgtiqskeggkvtvkteggetltvkedqvfs

Timeline for d2mysa1:

• d2mysa1 first appeared (with stable ids) in SCOP 1.55
  
• d2mysa1 appears in SCOP 1.69
  
• d2mysa1 appears in SCOP 1.73
  
• d2mysa1 appears in the current release, SCOPe 2.08