Lineage for d3cu7bd (3cu7 B:932-981,B:1307-1369)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777785Superfamily b.23.4: Complement system CUB domain [254131] (1 family) (S)
  5. 2777786Family b.23.4.1: Complement system CUB domain [254165] (2 proteins)
  6. 2777790Protein Complement C5 CUB domain [254372] (1 species)
  7. 2777791Species Human (Homo sapiens) [TaxId:9606] [254805] (1 PDB entry)
  8. 2777793Domain d3cu7bd: 3cu7 B:932-981,B:1307-1369 [245559]
    Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7be
    complexed with cd, nag

Details for d3cu7bd

PDB Entry: 3cu7 (more details), 3.11 Å

PDB Description: human complement component 5
PDB Compounds: (B:) Complement C5

SCOPe Domain Sequences for d3cu7bd:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu7bd b.23.4.1 (B:932-981,B:1307-1369) Complement C5 CUB domain {Human (Homo sapiens) [TaxId: 9606]}
egvkresysgvtldprgiygtisrrkefpyripldlvpkteikrilsvkgXlrlsmdidv
sykhkgalhnykmtdknflgrpvevllnddlivstgfgsglatvhvttvvhkts

SCOPe Domain Coordinates for d3cu7bd:

Click to download the PDB-style file with coordinates for d3cu7bd.
(The format of our PDB-style files is described here.)

Timeline for d3cu7bd: