Class b: All beta proteins [48724] (180 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.4: Complement system CUB domain [254131] (1 family) |
Family b.23.4.1: Complement system CUB domain [254165] (2 proteins) |
Protein Complement C5 CUB domain [254372] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254805] (1 PDB entry) |
Domain d3cu7bd: 3cu7 B:932-981,B:1307-1369 [245559] Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7be complexed with cd, nag |
PDB Entry: 3cu7 (more details), 3.11 Å
SCOPe Domain Sequences for d3cu7bd:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu7bd b.23.4.1 (B:932-981,B:1307-1369) Complement C5 CUB domain {Human (Homo sapiens) [TaxId: 9606]} egvkresysgvtldprgiygtisrrkefpyripldlvpkteikrilsvkgXlrlsmdidv sykhkgalhnykmtdknflgrpvevllnddlivstgfgsglatvhvttvvhkts
Timeline for d3cu7bd: