SCOPe 2.08: Domain d3cu7b8: 3cu7 B:1370-1513

Lineage for d3cu7b8 (3cu7 B:1370-1513)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.29: Macroglobulin [254121] (9 families)
   C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations

5. Family b.1.29.1: Alpha-macroglobulin receptor domain [254148] (4 proteins)
   Pfam PF07677

6. Protein Complement C5 MG8 [254363] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254796] (1 PDB entry)

8. Domain d3cu7b8: 3cu7 B:1370-1513 [245554]
   Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a9, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b9, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be
   complexed with cd, nag

Details for d3cu7b8

PDB Entry: 3cu7, 3.11 Å

PDB Description: human complement component 5

PDB Compounds: (B:) Complement C5

SCOPe Domain Sequences for d3cu7b8:

Sequence, based on SEQRES records:

>d3cu7b8 b.1.29.1 (B:1370-1513) Complement C5 MG8 {Human (Homo sapiens) [TaxId: 9606]}
tseevcsfylkidtqdieashyrgygnsdykrivacasykpsreesssgsshavmdislp
tgisaneedlkalvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgfls
patftvyeyhrpdkqctmfystsn

Sequence, based on observed residues (ATOM records):

>d3cu7b8 b.1.29.1 (B:1370-1513) Complement C5 MG8 {Human (Homo sapiens) [TaxId: 9606]}
tseevcsfylkidtqdiykrivacasykpsreesssgsshavmdislptgisaneedlka
lvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspatftvyeyhrp
dkqctmfystsn

Timeline for d3cu7b8:

• d3cu7b8 first appeared in SCOPe 2.04
  
• d3cu7b8 appears in SCOPe 2.07