Lineage for d3cu7ae (3cu7 A:982-1306)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722786Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2722835Protein Thio-ester containing domain (TED) from Complement C5 [254373] (1 species)
  7. 2722836Species Human (Homo sapiens) [TaxId:9606] [254806] (1 PDB entry)
  8. 2722837Domain d3cu7ae: 3cu7 A:982-1306 [245545]
    Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7bd
    complexed with cd, nag

Details for d3cu7ae

PDB Entry: 3cu7 (more details), 3.11 Å

PDB Description: human complement component 5
PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d3cu7ae:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu7ae a.102.4.4 (A:982-1306) Thio-ester containing domain (TED) from Complement C5 {Human (Homo sapiens) [TaxId: 9606]}
llvgeilsavlsqeginilthlpkgsaeaelmsvvpvfyvfhyletgnhwnifhsdplie
kqklkkklkegmlsimsyrnadysysvwkggsastwltafalrvlgqvnkyveqnqnsic
nsllwlvenyqldngsfkensqyqpiklqgtlpvearenslyltaftvigirkafdicpl
vkidtalikadnfllentlpaqstftlaisayalslgdkthpqfrsivsalkrealvkgn
ppiyrfwkdnlqhkdssvpntgtarmvettayalltslnlkdinyvnpvikwlseeqryg
ggfystqdtinaieglteysllvkq

SCOPe Domain Coordinates for d3cu7ae:

Click to download the PDB-style file with coordinates for d3cu7ae.
(The format of our PDB-style files is described here.)

Timeline for d3cu7ae: