Lineage for d3csfa4 (3csf A:726-1088)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218054Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 2218055Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2218056Species Human (Homo sapiens) [TaxId:9606] [56174] (65 PDB entries)
  8. 2218100Domain d3csfa4: 3csf A:726-1088 [245527]
    Other proteins in same PDB: d3csfa1, d3csfa2, d3csfa3
    automated match to d1e7ua4
    complexed with dw2

Details for d3csfa4

PDB Entry: 3csf (more details), 2.8 Å

PDB Description: crystal structure of pi3k p110gamma catalytical domain in complex with organoruthenium inhibitor dw2
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3csfa4:

Sequence, based on SEQRES records: (download)

>d3csfa4 d.144.1.4 (A:726-1088) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wfl

Sequence, based on observed residues (ATOM records): (download)

>d3csfa4 d.144.1.4 (A:726-1088) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgfkdev
lnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfg
hlgervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmt
gmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwfl

SCOPe Domain Coordinates for d3csfa4:

Click to download the PDB-style file with coordinates for d3csfa4.
(The format of our PDB-style files is described here.)

Timeline for d3csfa4: