SCOPe 2.06: Domain d3cqoa2: 3cqo A:151-293

Lineage for d3cqoa2 (3cqo A:151-293)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (37 species)
   not a true protein

7. Species Morone saxatilis [TaxId:34816] [255778] (1 PDB entry)

8. Domain d3cqoa2: 3cqo A:151-293 [245519]
   automated match to d3le0a_
   complexed with ca, cl, fuc

Details for d3cqoa2

PDB Entry: 3cqo, 2.32 Å

PDB Description: crystal structure of a f-lectin (fucolectin) from morone saxatilis (striped bass) serum

PDB Compounds: (A:) fbp32

SCOPe Domain Sequences for d3cqoa2:

Sequence; same for both SEQRES and ATOM records:

>d3cqoa2 b.18.1.0 (A:151-293) automated matches {Morone saxatilis [TaxId: 34816]}
genlalkgkatqsslfesgiaynaidgnqannwemascthtkntmdpwwrmdlsqthrvf
svkvtnrdsfekringaeirigdsldnngnhnprcavitsipagastefqcngmdgryvn
ivipgreeyltlcevevygsvld

Timeline for d3cqoa2:

• d3cqoa2 first appeared in SCOPe 2.04
  
• d3cqoa2 appears in SCOPe 2.05
  
• d3cqoa2 appears in SCOPe 2.07
  
• d3cqoa2 appears in the current release, SCOPe 2.08