Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries) |
Domain d3ck5c1: 3ck5 C:4-129 [245499] Other proteins in same PDB: d3ck5a2, d3ck5a3, d3ck5b2, d3ck5b3, d3ck5c2, d3ck5c3, d3ck5d2, d3ck5d3 automated match to d3bjsa1 complexed with mg |
PDB Entry: 3ck5 (more details), 2.3 Å
SCOPe Domain Sequences for d3ck5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ck5c1 d.54.1.0 (C:4-129) automated matches {Streptomyces coelicolor [TaxId: 100226]} iervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavatm vdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartpl wklfgg
Timeline for d3ck5c1: