SCOPe 2.04: Domain d3ck5a1: 3ck5 A:3-129

Lineage for d3ck5a1 (3ck5 A:3-129)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries)

8. Domain d3ck5a1: 3ck5 A:3-129 [245495]
   Other proteins in same PDB: d3ck5a2, d3ck5b2, d3ck5c2, d3ck5d2
   automated match to d3bjsa1
   complexed with mg

Details for d3ck5a1

PDB Entry: 3ck5, 2.3 Å

PDB Description: crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium

PDB Compounds: (A:) Putative racemase

SCOPe Domain Sequences for d3ck5a1:

Sequence; same for both SEQRES and ATOM records:

>d3ck5a1 d.54.1.0 (A:3-129) automated matches {Streptomyces coelicolor [TaxId: 100226]}
liervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavat
mvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartp
lwklfgg

Timeline for d3ck5a1:

• d3ck5a1 is new in SCOPe 2.04-stable
  
• d3ck5a1 appears in SCOPe 2.05
  
• d3ck5a1 appears in the current release, SCOPe 2.08