SCOPe 2.04: Domain d3ca9a_: 3ca9 A:

Lineage for d3ca9a_ (3ca9 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (11 species)
   not a true protein

7. Species Paramecium bursaria chlorella virus il3a [TaxId:46019] [255769] (3 PDB entries)

8. Domain d3ca9a_: 3ca9 A: [245475]
   automated match to d1sixa_
   complexed with dud, mg

Details for d3ca9a_

PDB Entry: 3ca9, 3 Å

PDB Description: Evolution of chlorella virus dUTPase

PDB Compounds: (A:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d3ca9a_:

Sequence; same for both SEQRES and ATOM records:

>d3ca9a_ b.85.4.0 (A:) automated matches {Paramecium bursaria chlorella virus il3a [TaxId: 46019]}
sefmssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgty
griaprsglaykygidvlagvidedytgevkvilyntterdyiikkgdriaqlileqivt
pgvavvld

Timeline for d3ca9a_:

• d3ca9a_ is new in SCOPe 2.04-stable
  
• d3ca9a_ appears in SCOPe 2.05
  
• d3ca9a_ appears in the current release, SCOPe 2.08, called d3ca9a1