Lineage for d3c6ea1 (3c6e A:1-297)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252195Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2252196Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2252197Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)
  6. 2252231Protein automated matches [226969] (3 species)
    not a true protein
  7. 2252236Species Dengue virus 2 thailand/16681/84 [TaxId:31634] [231875] (2 PDB entries)
  8. 2252238Domain d3c6ea1: 3c6e A:1-297 [245459]
    Other proteins in same PDB: d3c6ea2, d3c6ea3
    automated match to d3c5xa1
    protein/RNA complex; complexed with man, nag, ndg

Details for d3c6ea1

PDB Entry: 3c6e (more details), 2.6 Å

PDB Description: Crystal structure of the precursor membrane protein- envelope protein heterodimer from the dengue 2 virus at neutral pH
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d3c6ea1:

Sequence, based on SEQRES records: (download)

>d3c6ea1 f.10.1.1 (A:1-297) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]}
mrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkggivtcamfr
ckknmegkvvqpenleytivitphsgeehavgndtgkhgkeikitpqssiteaeltgygt
vtmecsprtgldfnemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Sequence, based on observed residues (ATOM records): (download)

>d3c6ea1 f.10.1.1 (A:1-297) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]}
mrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkggivtcamfr
ckknmegkvvqpenleytivitphsgeehagkhgkeikitpqssiteaeltgygtvtmec
sprtldfemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknphakk
qdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOPe Domain Coordinates for d3c6ea1:

Click to download the PDB-style file with coordinates for d3c6ea1.
(The format of our PDB-style files is described here.)

Timeline for d3c6ea1: